($) USD (Default)
  • ($) AUD
  • (€) EUR
  • ($) CAD
  • ($) NZD
  • (£) GBP

Kisspeptin Pre Mixed Peptide 5mg

$31.96$89.46

Research suggests that the peptide Kisspeptin has shown the following benefits:

  • Helps men produce testosterone
  • Can be  used as an effective infertility treatment
  • Enhances mood both emotional and sexual
  • Could potentially help prevent cancer cells from spreading in certain types of cancer

Out of stock

First time customer gets 15% discount code = 1storder

Kisspeptin Pre Mixed Peptide 5mg America

Kisspeptin Pre Mixed Peptide is a hormone that boosts sex-related attraction and also reduces stress and anxiety in men. The hormone is usually related to advancement throughout the age of puberty as well as maternity. It has actually been revealed to assist in dealing with male sex-related disorders.

The posterodorsal median location of the amygdala (MePD), where the Kisspeptin-responsive nerve cells were located, belongs to the mind called the amygdala. An area is main to controlling sex-related as well as psychological practices, such as anxiousness or social communication.


Kisspeptin Pre Mixed Peptide Benefits America

Testosterone Increase

LH and FDH circulating levels have been linked to changes in testosterone levels by kisspeptin-10. Kisspeptin 10 has a positive effect on testosterone levels in men but has no effect on testosterone levels in women.

Six men were given Kisspeptin intravenously as part of a America clinical trial. Just 90 minutes into the experiment, they saw a significant increase in testosterone levels, indicating that kisspeptin10 could be an effective testosterone-enhancing therapy.

Furthermore, Kisspeptin-10 has been shown to increase serum LH levels, raising testosterone levels in healthy men.

Mood-lifting

Kisspeptin peptide hormone is linked to reproduction and emotion, so it makes sense that it could also affect mood and behaviour.

Kisspeptin pre mixed peptide and a placebo were administered to 29 heterosexual men to test this hypothesis. Kisspeptin-10 increased limbic brain activity, boosted motivation, and improved mood in those who received it. On the other hand, the control group did not show any improvement in symptoms.

Kisspeptin has been shown to influence both sexual and emotional brain processing, as well as human behaviour.

Infertility treatment

Similarly, this peptide has been found to be an effective infertility treatment. Kisspeptin pre mixed peptide has been shown in studies to have profound effects on infertility. It may even be a better option than human chorionic gonadotropin (hCG) for women undergoing IVF treatment.

According to America research, none of the women treated with kisspeptin-10 before IVF developed ovarian hyperstimulation syndrome (OHS) (OHSS). This is excellent news, considering that only a small percentage of women treated with HCG develop the condition.

Prevents Cancer from Spreading

Kisspeptin-10 was discovered two decades ago to have a high success rate in suppressing malignant skin cancer. Kisspeptins’ ability to inhibit cell migration is responsible for this. In addition, America studies have shown that cancer cells are potentially less likely to invade other tissues when Kisspeptin is used.

Breast, prostate, ovarian, skin, thyroid, bladder, and gastrointestinal cancers show positive changes in Kisspeptin levels in screening for various metastatic cancer types. This is proof that Kisspeptin can help stop cancer from spreading.

There is the option America to buy Kisspeptide Nasal Spray and Kisspeptin Peptide Vial.


Research:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2717872/

Molecular Formula: C258H401N79O78
Molecular Weight:5857 g/mol
Sequence: GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF

 

Kisspeptin HPLC Certificate


Disclaimer: We do not supply sarms or peptides to any individual under the age of 21. You must be a licensed and qualified healthcare practitioner. Our team of dedicated professionals are committed to providing an extensive range of products used ONLY in the process of laboratory research by responsible trained and professional individuals. All products listed on this website (direct-sarms.com) and provided through Direct Sarms are intended for laboratory research purposes only. The products listed on this website are NOT for human or animal consumption or ingestion of any kind.

Additional information

Weight 0.01 kg
Dimensions 1 × 1 × 1 cm
size

Pen Kit, 1 cartridge, 2 cartridges, 3 cartridges

Pen instructions

All pre-mixed cartridges are mixed with 2ml bacteriostatic water, pens will release approximately 0.5ml per 60 dials on the pen (one full pen)

To achieve the number of micrograms (mcg) that 1 dial on the pen will release you will need to simply divide the amount of product:

2mg = 2000mcg

5mg = 5000mcg

by the full amount of pen dials (which will always be 240)

E.g., 5000mcg divided by 240 = 20.83, therefore 1 dial on the pen for all 5mg products will release approximately 20.83mcg.